PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSMUA_Achr2P06420_001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Zingiberales; Musaceae; Musa
Family TALE
Protein Properties Length: 369aa    MW: 40716.6 Da    PI: 5.3258
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSMUA_Achr2P06420_001genomeCIRADView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox22.22.3e-073273592050
                            HH..SSS--HHHHHHHHHHCTS-HHHHHHHHHH CS
               Homeobox  20 ek..nrypsaeereeLAkklgLterqVkvWFqN 50 
                            e   ++yp  +e+  LAk++gLt +qV++WF N
  GSMUA_Achr2P06420_001 327 EHflDPYPINSEKLMLAKQTGLTRSQVSNWFIN 359
                            544489*************************99 PP

2BELL44.44.2e-15268307140
                   BELL   1 erqelqkkkakLlslleeVdkrYkqyveqlqtvissFeav 40 
                            e q+lq k +kLl +l+eV   Ykqy +q+qt +ssF++v
  GSMUA_Achr2P06420_001 268 ETQDLQDKVTKLLAMLDEVLYLYKQYFHQMQTTVSSFDEV 307
                            5799**********************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005742.5E-6186331IPR006563POX domain
PfamPF075268.6E-23199308IPR006563POX domain
CDDcd000862.32E-8308360No hitNo description
SuperFamilySSF466899.84E-12310363IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.606.1E-19311363IPR009057Homeodomain-like
PfamPF059201.6E-14324360IPR008422Homeobox KN domain
PROSITE profilePS500719.442326363IPR001356Homeobox domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 369 aa     Download sequence    Send to blast
MSTFFLNPSN QMDKIPNLHM REPGHYRSSG ASVLGNLQYH NYSSSIAISD TLAAGDTQPQ  60
QNSIELSVSL GSTRGNLDTV TSCTGEHAYG SWKDGKNEMS FMQTVSVAIE DEEDLLHGNE  120
PQISLQRELG MLDRQSLSLQ LSDVSTMPCQ GLSLSLTTQI PVPSIQYLPG SSDLSLFCPH  180
QTTSGSGVSC RNQNYQNMTY LKAGQQLLNE VVNVHKALKQ HSDKAQNLHS SPINSMDKDG  240
TAKSKGEGKS TNPQDSTINS STELSLSETQ DLQDKVTKLL AMLDEVLYLY KQYFHQMQTT  300
VSSFDEVRPQ SGLPDSSVSI LCAWLFEHFL DPYPINSEKL MLAKQTGLTR SQVSNWFINA  360
LVRLCFGSL
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009386368.10.0PREDICTED: BEL1-like homeodomain protein 3 isoform X1
TrEMBLM0S5N30.0M0S5N3_MUSAM; Uncharacterized protein
STRINGGSMUA_Achr2P06420_0010.0(Musa acuminata)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G75410.21e-25BEL1-like homeodomain 3